{{#pushedProductsPlacement4.length}} {{#each pushedProductsPlacement4}}
{{product.defLight}}
{{#if company.requestButtonsVisibility.requestButtonQuestion == "ACTIVE"}}
{{elseif company.requestButtonsVisibility.requestButtonWhereToBuy == "ACTIVE"}}
{{/if}}
{{product.productLabel}}
{{product.model}}

{{#each product.specData:i}} {{name}}: {{value}} {{#i!=(product.specData.length-1)}}
{{/end}} {{/each}}

{{{product.idpText}}}

{{productPushLabel}}
{{#if product.newProduct}}
{{/if}} {{#if product.hasVideo}}
{{/if}}
{{/each}} {{/pushedProductsPlacement4.length}}
{{#pushedProductsPlacement5.length}} {{#each pushedProductsPlacement5}}
{{product.defLight}}
{{#if company.requestButtonsVisibility.requestButtonQuestion == "ACTIVE"}}
{{elseif company.requestButtonsVisibility.requestButtonWhereToBuy == "ACTIVE"}}
{{/if}}
{{product.productLabel}}
{{product.model}}

{{#each product.specData:i}} {{name}}: {{value}} {{#i!=(product.specData.length-1)}}
{{/end}} {{/each}}

{{{product.idpText}}}

{{productPushLabel}}
{{#if product.newProduct}}
{{/if}} {{#if product.hasVideo}}
{{/if}}
{{/each}} {{/pushedProductsPlacement5.length}}
Turbinen-Strömungssensor / Gas / Inline / Miniatur
Turbinen-Strömungssensor
FLR1000 series

... Die Durchflusssensoren der Serie FLR1000 sind in der Lage, niedrige Durchflussraten von 20 mL/min bis 500 L/min zu quantifizieren. Damit sind diese Sensoren ideal für ein breites Anwendungsspektrum wie z.B. in kommerziellen, labortechnischen ...

thermischer Strömungssensor / für Flüssigkeiten / Gas / mit integrierter Digitalanzeige
thermischer Strömungssensor
SA series

Mit integrierten Medienkurven für Wasser, Öle und Luft Gleichzeitige Messung von Strömung und Temperatur Rot-Grün-Farbumschaltung für Prozesswerte möglich Einstellbarer Rohrinnendurchmesser von 25...400 mm Optimale ...

Strömungssensor für rauhe Umgebung / für Flüssigkeiten / Gas / mit integrierter Digitalanzeige
Strömungssensor für rauhe Umgebung
SI series

Hohe Reproduzierbarkeit Einfacher Einstellmodus für schnelle Inbetriebnahme Variabler Prozessanschluss über Adapter Zuverlässige Überwachung von gasförmigen und flüssigen Medien Elektronische Verriegelung der Einstellwerte

Strömungssensor für Flüssigkeiten / für Hygieneanwendungen / Gas / mit integrierter Digitalanzeige
Strömungssensor für Flüssigkeiten
SI6 series

Speziell für den Einsatz in hygienischen Applikationen Geeignet für Mediumtemperaturen bis 120 °C LED-Bargraph für Anzeige von Schaltpunkt und Strömungszustand Umfangreiches Sortiment an Prozessadaptern im Zubehör ...

Impeller-Strömungssensor / Gas / für Flüssigkeiten / elektronisch
Impeller-Strömungssensor
RFS

RotorFlow® Schalter machen Ihre Ausrüstung noch zuverlässiger und sicherer. Die Funktionsweise verhindert, dass der Rotor einen Strömungsvorgang anzeigt, wenn tatsächlich keine Strömung existiert. Wenn der RotorFlow® auf den gewünschten ...

Impeller-Strömungssensor / Gas / für Flüssigkeiten / Präzision
Impeller-Strömungssensor
RFO, RFA

Gems™ Sensors hat das Schaufelraddesign RotorFlow® bekannt gemacht, indem wir die gut sichtbaren Rotoren mit Halbleiter-Elektronik kombiniert und in einem Schalttafeleinbaugehäuse montiert haben. Sie bieten einen präzisen Strömungswertausgang ...

Turbinen-Strömungssensor / Gas / für Flüssigkeiten / Inline
Turbinen-Strömungssensor
FT-210 series

Gems™ FT-210 bietet bewährte Turbinentechnologie in einem kleinen Gehäuse für Anwendungen mit niedrigen Strömungswerten. Die Turbinentechnologie sorgt für Sensoren mit hoher Reproduzierbarkeit, die ideal für die Messung von Volumendosierungen ...

Luftströmungssensor / Inline
Luftströmungssensor
HAF Series

Differenzdruck-Strömungssensor / Luft / mit Analogausgang
Differenzdruck-Strömungssensor
Zephyr™

Differenzdruck-Strömungssensor / Luft / mit Digitalausgang
Differenzdruck-Strömungssensor
Zephyr™

MEMS-Strömungssensor / Gas / mit Analogausgang / mit integrierter Digitalanzeige
MEMS-Strömungssensor
FM-200

Panasonic hat einen neuen digitalen Durchflusssensor mit integriertem Display für ein breites Spektrum an Applikationen entwickelt. Die Sensoren der Serie FM-200 können Luftströme ermitteln, und diese Werte zur weiteren Regelung in verschiedenen ...

thermischer Strömungssensor / Luft
thermischer Strömungssensor
SS 20.261

Die preiswerte Alternative bei Überdruck bis zu 10 bar Die Erzeugung von Druckluft ist ein kostenintensiver Prozess. Es lohnt sich somit, Druckluftnetze zu optimieren. Der erste Schritt ist das „Wissen“ wie und wo man mit der Optimierung ansetzt.

Die anderen Produkte ansehen
SCHMIDT Technology
thermischer Strömungssensor / Gas
thermischer Strömungssensor
SS 20.600

Durchflussmengen von Gasen – eine wichtige Messgröße in Industrie-Prozessen Das Erfassen von Durchflussmengen in Industrieprozessen ist ein wichtiger Bestandteil von Maßnahmen zur Energieeinsparung, Qualitätssicherung im Produktionsprozess, ...

Die anderen Produkte ansehen
SCHMIDT Technology
LED-Strömungssensor / Gas / mit Digitalausgang
LED-Strömungssensor
SS 30.30x series

Strömungssenson zur Volumenstrom-Messung in Druckluft und Gasen mit integrierter LED-Anzeige und konfigurierbaren Ausgängen nutzbar als Analog- und Impulsausgang oder Schaltausgängen.

Die anderen Produkte ansehen
SCHMIDT Technology
Pitotrohr-Strömungssensor / Differenzdruck / Massen / Luft
Pitotrohr-Strömungssensor

systec Controls entwickelt, fertigt und vertreibt seit über 15 Jahren Staudrucksonden zur Messung von Gasen und Flüssigkeiten. Weltweit gehört systec Controls zu einem der führenden Hersteller von Staudrucksonden für industrielle Anwendungen. Am ...

Massenströmungssensor / Differenzdruck / Luft / OEM
Massenströmungssensor
TFI4

Die TFI4-Elektronik ist ein Sensorsystem bestehend aus Differenzdruck-, Absolutdruck-, und Temperatursensoren. Ein CAN-Bus sorgt für die Anbindung an eine Motorsteuerung (ECU) oder andere Rechensysteme. Die TFI4 verfügt über einen leistungsfähigen ...

thermischer Strömungssensor / Massen / Luft / Miniatur
thermischer Strömungssensor
MCS100

... Die Luftmassenstromsensoren der Serie MCS100 eignen sich zur Luftmengenmessung in verschiedenen Arten von physikalisch-wissenschaftlichen Geräten sowie zur Bestätigung der Vakuumansaugung von winzigen elektronischen Bauteilen. Merkmale ...

Massenströmungssensor / Luft / kompakt
Massenströmungssensor
MCS200

... Die kompakten Luftmassenstromsensoren der Serie MCS200 können mit Atmosphärenanalysatoren zur Messung des Luftdurchsatzes oder mit Gasanalysatoren zur Messung des Stickstoffdurchsatzes verwendet werden und können zur Bestätigung des Vakuumansaugens ...

thermischer Strömungssensor / Luft / Eintauchfühler
thermischer Strömungssensor
HD 103T.0

Das HD103T.0 misst die Luftgeschwindigkeit mit einer omnidirektionalen Hitzdrahtsonde. Es ist mit drei wählbaren Analog-Ausgängen ausgestattet: zwei 4…20mA oder 0…20mA Stromausgängen und einem 0…10Vdc Spannungsausgangssignal (Auf Anfrage ...

thermischer Strömungssensor / Massen / Gas / Eintauchfühler
thermischer Strömungssensor
TA2

Thermatel TA2 ist ein thermischer Massedurchflussmessumformer, der zuverlässige Massemessungen von Luft- und Gasdurchfluss liefert. Der TA2 ist ab Werk abgeglichen und entsprechend den Anwendungen des Kunden eingerichtet. Die leistungsfähige ...

thermischer Strömungssensor / Massen / Luft / programmierbar
thermischer Strömungssensor
LDN 1000

Für die Verbrauchsmessung in Druckluftnetzen: • Leckageerkennung • Zusätzliche Druck- und Temperaturmessung • Benutzerebenen konfigurierbar • Manipulationserkennung • Komfortable Einstellung über IO-Link Schnittstelle Die Geräte ...

Venturi-Strömungssensor / Vakuum / Luft / Inline
Venturi-Strömungssensor
F-4417 series

... Die Sensor-Venturis sind fluidische Vorrichtungen, die Strömungsänderungen durch Entlüftungssensoren in Ein-/Aus-Drucksignale umwandeln. Die Sensor-Venturis F-4417-10 und -15 sind Einzelgeräte, die für zwei verschiedene Versorgungsdruckbereiche ...

Venturi-Strömungssensor / Feder-Potentiometer / Luft / Eintauchfühler
Venturi-Strömungssensor
F-4419-120

... Merkmale Zuverlässiger Betrieb Einfache Montage Schnelle Reaktion Der Federsensor ist ein Grenzsensor, der für einen einfachen und zuverlässigen Betrieb ausgelegt ist. Es funktioniert wie ein Schnurrhaarklappe und besteht ...

thermischer Strömungssensor / für rauhe Umgebung / Luft / mit Temperaturmessung
thermischer Strömungssensor
eYc FTM06

... Sehr geehrter Besucher 1.eYc sucht eine Partnerschaft für Distributor/Agenten/SI 2. Die neuesten Kataloge finden Sie unter eyc-tech.com 3.Die hierin enthaltenen Spezifikationen können ohne Vorankündigung geändert werden Für weitere Informationen ...

thermischer Strömungssensor / Luft / Eintauchfühler
thermischer Strömungssensor
eYc FTS34/35

... Sehr geehrter Besucher 1.eYc sucht eine Partnerschaft für Distributor/Agenten/SI 2. Die neuesten Kataloge finden Sie unter eyc-tech.com 3.Die hierin enthaltenen Spezifikationen können ohne Vorankündigung geändert werden Für weitere Informationen ...

Strömungssensor für Flüssigkeiten / für Kühlsysteme / Gas
Strömungssensor für Flüssigkeiten
AS-FS

... FCI stellt Strömungsschalter zur Verfügung, die ein Sensorelement ohne bewegliche Teile mit integrierter oder entfernter Elektronik verwenden, die den Durchfluss über oder unter einem vorbestimmten Sollwert am Messort anzeigen. Das Strömungselement ...

Strömungssensor für Flüssigkeiten / Gas
Strömungssensor für Flüssigkeiten
AS-FS

... Der AS-FS Dual Output Durchflusssensor von FCI bietet vollständig redundante und separate Ausgänge in der gleichen Umrandungsdimension wie die Designs der einzelnen Sensorausgänge. Dies wird durch den Einsatz von zwei elektrisch unabhängigen ...

Strömungssensor für Flüssigkeiten / Gas / Hochpräzision / Inline
Strömungssensor für Flüssigkeiten
AS-FT

... FCI bietet Durchflusstransmitter an, die ein Schutzrohr-Messelement und eine integrierte oder entfernte Elektronik beinhalten, die den Durchfluss am Messort genau anzeigt. Das Strömungselement wird direkt in Rohrleitungen oder Leitungen ...

thermischer Strömungssensor / Massen / Dünnschicht / Gas
thermischer Strömungssensor
FS7

Der IST AG FS7 Strömungssensor mit symmetrischem Heizerdesign und verbesserter Empfindlichkeit ist der Nachfolger des FS5 Strömungssensors. Er wird zur Messung von Gasen eingesetzt und bietet eine hervorragende Langzeitstabilität. Die ...

Die anderen Produkte ansehen
Innovative Sensor Technology IST AG
kalorimetrischer Strömungssensor / Silizium / Gas / zur Prozessüberwachung
kalorimetrischer Strömungssensor
SFS01

Der SFS01 eignet sich besonders für kleine Strömungsgeschwindigkeiten bis zu 3.5 m/s (in Gasen). Er zeigt sehr schnelle Messergebnisse der Durchflussrate sowie der Strömungsrichtung. Der Silizium-Strömungssensor SFS01 zeichnet sich ...

Die anderen Produkte ansehen
Innovative Sensor Technology IST AG
thermischer Strömungssensor / Massen / Dünnschicht / Gas
thermischer Strömungssensor
FS7.4W

Der IST AG FS7.4W Strömungssensor wurde für Applikationen mit einer Temperatur von bis zu 400 °C entwickelt. Das Design des FS7.4W basiert auf dem FS7 mit symmetrischem Heizer für eine erhöhte Empfindlichkeit. Der FS7.4W wird zur Messung ...

Die anderen Produkte ansehen
Innovative Sensor Technology IST AG
Potentiometer-Strömungssensor / kalorimetrisch / für rauhe Umgebung / für Kühlsysteme
Potentiometer-Strömungssensor
vent-captor 3202.0X

AKTUALISIERTE VERSION: Strömungswächter für Luft und andere Gase (Messbereich 0,5 m/s bis 50 m/s) Unterschiede zu alten Version: - Sensorfühler: PT100/PT1000 (alt: Substrate) - Messbereich: 0,5 m/s - 50 m/s (alt: 0,5 m/s - 20 m/s) - ...

Die anderen Produkte ansehen
weber Sensors GmbH
kalorimetrischer Strömungssensor / für rauhe Umgebung / für Kühlsysteme / für HLK
kalorimetrischer Strömungssensor
vent-captor 3302.30/xx

Ausgang: analog 4-20mA Messprinzip: kalorimetrisch Messbereich: 0-5 m/s, 0-10 m/s, 0-20 m/s und 0-30 m/s Sensorrohrgrößen: von 8 - 28mm (OD) Betriebsspannung: 18 - 30 VDC Optionen: auch als Sonderausführung S161 (Druck bis 16 bar) erhältlich

Die anderen Produkte ansehen
weber Sensors GmbH
kalorimetrischer Strömungssensor / für rauhe Umgebung / für Kühlsysteme / für HLK
kalorimetrischer Strömungssensor
vent-captor 3302.1x/xx

Inline Strömungswächter für Luft und andere Gase Ausgang: Transistor (PNP Schließer / PNP Öffner) Messprinzip: kalorimetrisch Messbereich: 0,5 bis 20 m/s Sensorrohrgrößen: von 8 - 28 mm (OD) Betriebsspannung: 18 - 30 VDC

Die anderen Produkte ansehen
weber Sensors GmbH
thermischer Strömungssensor / Luft
thermischer Strömungssensor
EE75

thermischer Strömungssensor / Massen / Gas / OEM
thermischer Strömungssensor

... Massendurchflusssensorsonden, die Ihren OEM-Anforderungen entsprechen Großer Durchflussbereich von 0 bis 20.000 sfpm Erhöhen Sie die Flexibilität bei geringem Druckverlust Ablehnung: 1000:1 Patentierter DrySense™ Sensor ...

Turbinen-Strömungssensor / Gas / für Flüssigkeiten / Inline
Turbinen-Strömungssensor

Impeller-Strömungssensor / Gas / für Flüssigkeiten / Inline
Impeller-Strömungssensor
250, 228 series

... 250-228 Sensoren Die Strömungssensoren der Serie 228/250 verfügen über ein sechsschaufliges Laufraddesign mit einem patentierten nichtmagnetischen Sensormechanismus. Die nach vorne geschwungene Laufradform bietet ein höheres, gleichmäßigeres ...

Die anderen Produkte ansehen
Badger Meter
Impeller-Strömungssensor / Gas / für Flüssigkeiten / Inline
Impeller-Strömungssensor
735 series

... Serie 735 Sensor Die Strömungssensoren der Badger Meter Serie 735 verfügen über ein vierschaufliges, robustes und nicht verschmutzendes Laufrad. Diese unmagnetische Sensorik reduziert den Luftwiderstand und ermöglicht schnelle Änderungen ...

Die anderen Produkte ansehen
Badger Meter
Impeller-Strömungssensor / thermisch / Gas / für Flüssigkeiten
Impeller-Strömungssensor
380 Btu Meter series

Die anderen Produkte ansehen
Badger Meter
thermischer Strömungssensor / Gas / für Flüssigkeiten / mit integrierter Digitalanzeige
thermischer Strömungssensor
FM-200

thermischer Strömungssensor / Luft
thermischer Strömungssensor
REVEN® RSC series

Energiesparsensor für Erfassungshauben und Lüftungsdecken Überwachung, Steuerung und Regelung des Abluftstromvolumens in Kanalsystemen, Erfassungshauben und Lüftungsdecken.

thermischer Strömungssensor / Gas / Eintauchfühler
thermischer Strömungssensor
SL180100

Die Funktion des Strömungssensors beruht auf dem kalorimetrischen Prinzip. Der Messfühler wird um einige Grade Celsius von innen heraus gegenüber dem Strömungsmedium, in welches er hineinragt, aufgeheizt. Fließt das Medium, so wird die ...

Die anderen Produkte ansehen
ipf electronic
Differenzdruck-Strömungssensor / Luft
Differenzdruck-Strömungssensor
XAFP 100

Ihr Vorteil für mehr Energieeffizienz Effiziente Erfassung von Luftvolumenströmen zur bedarfsgerechten Lüftung in Lüftungs- und Klimaanlagen Eigenschaften Strömungssonde zur präzisen und kostengünstigen Erfassung von Wirkdrucksignalen ...

thermischer Strömungssensor / Luft
thermischer Strömungssensor
SF/C

Der Strömungsfühler SF/C erfasst die Strömungsgeschwindigkeit im Bereich von 0-20 m/s und optional auch die Temperatur von 0...+50°C und wandelt den Messwert in ein lineares Ausgangsignal 0-10 V bzw. 4-20 mA um. Der Strömungsfühler ist ...